PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G301000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 234aa    MW: 25264.5 Da    PI: 8.8878
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G301000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.8e-21666257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        ++R+++t+eql +Lee++++  r+p+a+e+++++++l    +++ ++V++WFqN++a+e++
  Brast05G301000.1.p  6 STRWCPTPEQLMILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 66
                        58*****************99**************************************97 PP

2Wus_type_Homeobox121.34e-39567264
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        ++tRW+PtpeQ++iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+
  Brast05G301000.1.p  5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 67
                        689***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.463267IPR001356Homeobox domain
SMARTSM003896.8E-6471IPR001356Homeobox domain
SuperFamilySSF466899.41E-12470IPR009057Homeodomain-like
CDDcd000867.84E-4560No hitNo description
PfamPF000461.5E-18666IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.6E-8866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH  60
KARERQRLRR RLCARHQQAA SPSPMATPPP PAAAAASAAN VMHPAVMQLH HPYTACSFMP  120
PQGYLQQDAG GAAPVSGLEF AAAAAGGGGK AHQQHHEWTT QQQQQQMMMM MTENNNNINA  180
GSGSSGAGGM APPPWPCCRP LRTLELFPTK STGGGLRDEC SSSKSSSCST STN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9690871e-103EU969087.1 Zea mays clone 325979 WUSCHEL-related homeobox 3B mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105160.12e-61WUSCHEL-related homeobox 3A
SwissprotQ70UV12e-63WOX3A_MAIZE; WUSCHEL-related homeobox 3A
TrEMBLA0A0Q3LJN33e-82A0A0Q3LJN3_BRADI; Uncharacterized protein
STRINGMLOC_7772.19e-77(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.14e-34WOX family protein